HORDB

ID: hor005686
Uniprot ID: Q9EPS2
Protein name: Peptide YY
Gene name: Pyy
Organism: Mus musculus (Mouse)
Family: NPY family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0032096 negative regulation of response to food; GO:0042755 eating behavior
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
Length: 36
Propeptide: MVAVRRPWPVTVAMLLILLACLGALVDAYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRYGKRDVPAALFSKLLFTDDSDSENLPFRPEGLDQW
Signal peptide: MVAVRRPWPVTVAMLLILLACLGALVDA
Modification: T13 Phosphoserine;T36 Tyrosine amide
Glycosylation: NA
Mutagenesis: NA

Function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Mechanism: NA
Cross BBB: NO
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005686_AF2.pdb

hor005686_ESM.pdb

Mass:	486613	Formula:	C190H287N53O58
Absent amino acids:	CFIMW	Common amino acids:	Y
pI:	7.52	Basic residues:	6
Polar residues:	11	Hydrophobic residues:	9
Hydrophobicity:	-109.44	Boman Index:	-9960
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	62.5
Instability Index:	9299.17	Extinction Coefficient cystines:	7450
Absorbance 280nm:	212.86